Converting GenBank (or other formats) to Fasta
Brad Chapman (chapmanb@uga.edu)
Table of Contents
1 Background and Purpose
One of the most common file formats used in biology is Fasta format,
thus converting into this format for storage of sequences or preparation for
input into a program is very common. Fasta format has become so
popular because it is very simple. It consists of two parts, a title
line which begins with a >
character, and then a number of
sequence lines. Here's an example Fasta sequence:
>gi|3318709|pdb|1A91| Subunit C Of The F1fo Atp Synthase Of Escherichia Coli
MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVDAIPMIAVGL
GLYVMFAVA
This document will discuss ways in Biopython to convert a file of
GenBank records into a file of Fasta sequences. Although Fasta format is
simple, it can also be difficult to deal with because there are no
standards for how information about a sequence will be presented on the
title line. Because of this we'll discuss two ways to do conversions:
-
A quick and easy way which assumes that you don't need specialized
control over the way output is produced on the title line.
- A more controlled way which allows you to construct
title lines to your specifications.
These examples assume some basic familiarity with constructing Biopython
Parsers and Iterators, and some understanding of the SeqRecord
object in Biopython.
2 Quick conversion using the FormatIO system
If you only want a quick and easy to type way to convert GenBank to
Fasta format with reasonable title names, Biopython has an
in-development format conversion mechanism. If you've used BioPerl, this
mechanism is similar to that used in their SeqIO
system.
Basically, it involves converting GenBank records into standard
Biopython SeqRecord
objects, and then converting these
SeqRecord
objects back into a Fasta record in a file. As we
mentioned, this mechanism is easy, so all of this work is done
internally within Biopython code.
Now that we understand how things will be working internally, let's
write the code that drives the conversion process.
First, we open up a handle to read from the GenBank file, and a handle
to write to the output Fasta file. Assuming you've somehow defined
input_file
, which is an existing file of GenBank records, and
output_file
, the name of the output file, this is just standard python:
input_handle = open(input_file)
output_handle = open(output_file, "w")
Now, we create a Biopython FormatIO
object which will, using
SeqRecord
objects, be converting between GenBank format and Fasta
format. First, we get the Biopython registry of formats:
from Bio import formats
The imported formats
object contains a dictionary-like interface to
biological file formats able to be dealt with through the
FormatIO
system. A simple print formats
gives you a list
of all the available formats:
formats, exporting 'blast', 'blastn', 'blastp', 'blastx', 'embl', 'embl/65',
'empty', 'fasta', 'genbank', 'genbank-records', 'genbank-release',
'ncbi-blastn', 'ncbi-blastp', 'ncbi-blastx', 'ncbi-tblastn', 'ncbi-tblastx',
'search', 'sequence', 'swissprot', 'swissprot/38', 'swissprot/40',
'tblastn', 'tblastx', 'wu-blastn', 'wu-blastp', 'wu-blastx'
The important thing to note is that we've got our genbank
and
fasta
formats we want to deal with. With these formats, we can
create a formatter with one line of code:
formatter = FormatIO("SeqRecord", formats["genbank"], formats["fasta"])
With the formatter in hand, the actual conversion is also a very simple
single line of code, using our input and output handles defined above:
formatter.convert(input_handle, output_handle)
That's it -- we've done the conversion. Assuming we have a GenBank file
beginning like:
LOCUS ATCOR66M 513 bp mRNA PLN 02-MAR-1992
DEFINITION A.thaliana cor6.6 mRNA.
ACCESSION X55053
VERSION X55053.1 GI:16229
This will output Fasta that looks like:
>X55053.1 A.thaliana cor6.6 mRNA.
aacaaaacacacatcaaaaacgattttacaagaaaaaaatatctgaaaaatgtcagagaccaacaagaatgc
Thus, the id (accession number with versioning) and description are
maintained in the final Fasta title.
3 Specialized conversion using Fasta Record objects
If the generally useful scheme described above for retaining sequence
information in the Fasta title does not work for your purposes, it is
always possible to hand create your own system for conversion between
GenBank information and Fasta titles.
This involves using the standard Fasta Record
object. The
important thing about this object, for our purposes, is that if you have
a Fasta record object and get the string representation of it (by
printing or calling str
on the object) it will output nicely
formatted Fasta. Thus, we need to only set the title
and
sequence
attributes of the Fasta record, and we can write out
nice Fasta.
Now that the preliminaries are out of the way, we'll get down to doing
the work. First, we create a GenBank Iterator which will read over the
input file and return GenBank Record objects:
from Bio import GenBank
iterator = GenBank.Iterator(input_handle, GenBank.RecordParser())
Now, using the information we learned above about Fasta Records, we can
write out a Fasta file with complete control over how the tile looks. In
this example case, we'll just store information about the GI number,
LOCUS name, version, and description in the title line. We then loop
over the GenBank records and write out the Fasta Records one at a time:
from Bio import Fasta
for gb_rec in iterator:
fasta_rec = Fasta.Record()
fasta_rec.title = "%s|%s|%s %s" % \
(gb_rec.gi, gb_rec.locus, gb_rec.version, gb_rec.definition)
fasta_rec.sequence = gb_rec.sequence
output_handle.write(str(fasta_rec) + "\n")
This will produce an output file that, given the GenBank we showed
above, looks like:
>16229|ATCOR66M|X55053.1 A.thaliana cor6.6 mRNA.
AACAAAACACACATCAAAAACGATTTTACAAGAAAAAAATATCTGAAAAATGTCAGAGAC
To adjust what is written on the title line, all we need to change from
the code above is the line specifying what makes up
fasta_rec.title
.
4 Beyond GenBank to Fasta
Although this example describes converting GenBank to Fasta, other
conversions are possible using the same frameworks.
For the FormatIO
system, conversions from Swissprot or EMBL
format to Fasta should work just as easily by replacing the
formats["genbank"]
dictionary call above with swissprot
or
embl
. Currently, the FormatIO
system is still under
development and writing other formats besides Fasta is not yet
supported. Other output formats will hopefully be added in the future.
For the Fasta Record system, any input format can be used that is
supported by parsing in Biopython. For output, the GenBank Record class
also supports string output in GenBank flat file format.
This document was translated from LATEX by
HEVEA.